General Information

  • ID:  hor000953
  • Uniprot ID:  P01353
  • Protein name:  Big gastrin
  • Gene name:  GAST
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QLGLQGPPQLVADLSKKQGPWMEEEEAAYGWMDF
  • Length:  34
  • Propeptide:  MQRLCVYVLILALALATFSEASWKPRSRLQDAPSGPGANRGLEPHGLDQLGPASHHRRQLGLQGPPQLVADLSKKQGPWMEEEEAAYGWMDFGRRSAEEGDQRP
  • Signal peptide:  MQRLCVYVLILALALATFSEA
  • Modification:  T1 Pyrrolidone carboxylic acid;T18 Pyrrolidone carboxylic acid;T29 Sulfotyrosine;T34 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01353-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000953_AF2.pdbhor000953_ESM.pdb

Physical Information

Mass: 443915 Formula: C174H258N42O53S2
Absent amino acids: CHINRT Common amino acids: EGLQ
pI: 3.84 Basic residues: 2
Polar residues: 6 Hydrophobic residues: 11
Hydrophobicity: -63.82 Boman Index: -3623
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 63.24
Instability Index: 7585.29 Extinction Coefficient cystines: 12490
Absorbance 280nm: 378.48

Literature

  • PubMed ID:  3763441
  • Title:  Sequences of gastrins purified from a single antrum of dog and of goat.